DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and kirrel1b

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:380 Identity:89/380 - (23%)
Similarity:156/380 - (41%) Gaps:81/380 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVWSTLLLAIFVQQTLA---QRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPV 70
            ||.|.|...:..:.|:.   ...||:....:.:....|..|:|.|..            |.:.|:
Zfish   204 CVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQA------------TANPPI 256

  Fly    71 F---LSTGSTLV--IKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLS 130
            .   .:.|..::  .::|.|....|.:..|..:             :| :|.:.|...:..:.:.
Zfish   257 MGYRWAKGGVILDGARESVFETTADHSFFTEPV-------------SC-LVFNAVGSTNVSILVD 307

  Fly   131 VRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVK 195
            |...|::. ...:.|.....|:|.:.|..||.|..|:||.::.::::.::|     |.|.:|||.
Zfish   308 VHFGPILV-VEPRPVTVDVDSDVTLNCKWSGNPPLTLTWTKKGSSMVLSNS-----NQLFLKSVS 366

  Fly   196 KEDRGTYYC---VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDM-----DLECHIEAY 252
            :.|.|.|.|   |...||.:.:   :.:.|...|:|:      .:.:||.:     :::|:|.:.
Zfish   367 QADAGQYVCKAIVPRIGVGETE---VTLTVNGPPIIS------SEPIQYAVRGEKGEIKCYIAST 422

  Fly   253 PPP-AIVWT-KDDIQLANN----QHYSI--SHFATADEYTDSTLRVITVEKRQY-GDYVCKATNR 308
            ||| .|||. |:::.....    :.|::  |..||......|||.:..|.:..: ..|.|.|.|.
Zfish   423 PPPDKIVWAWKENVWEKERGTLLERYTVEQSRPATQGGAVLSTLTINNVMEADFQSTYNCTAWNA 487

  Fly   309 FGEAEARVNLFET------IIPVCPPACGQAYIAGAEDVSATSFALVGILAALLF 357
            ||.....:.|.||      |:||       ..|||..  ..:|..|:.:|.||:|
Zfish   488 FGPGTMIITLEETDIASEDIVPV-------GVIAGGS--VGSSILLLLLLFALIF 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 14/99 (14%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 0/7 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 2/18 (11%)
Ig strand C' 68..72 CDD:409353 1/6 (17%)
Ig strand C' 79..81 CDD:409353 0/3 (0%)
FR3 84..115 CDD:409353 4/30 (13%)
Ig strand D 84..90 CDD:409353 1/5 (20%)
Ig strand E 94..102 CDD:409353 1/7 (14%)
Ig strand F 108..115 CDD:409353 1/6 (17%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 22/76 (29%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 2/3 (67%)
Ig strand F 201..206 CDD:409353 2/7 (29%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 26/104 (25%)
Ig strand C 256..260 CDD:409353 2/3 (67%)
Ig strand E 286..290 CDD:409353 3/3 (100%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.