| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001922015.4 | Gene: | si:ch211-74m13.1 / 100149459 | ZFINID: | ZDB-GENE-081104-12 | Length: | 328 | Species: | Danio rerio |
| Alignment Length: | 265 | Identity: | 47/265 - (17%) |
|---|---|---|---|
| Similarity: | 95/265 - (35%) | Gaps: | 72/265 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 113 CQVVIS-TVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMEC---YASGYPTPTITWRREN 173
Fly 174 NAILPTDSATYVGNT---------LRIKSVKKEDRGTYYCVADNGVS--------KGDRRNINVE 221
Fly 222 VEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDS 286
Fly 287 TLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGI 351
Fly 352 LAALL 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 5/18 (28%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | |||
| Ig strand F | 108..115 | CDD:409353 | 1/1 (100%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 16/85 (19%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 3/12 (25%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 19/90 (21%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| si:ch211-74m13.1 | XP_001922015.4 | Ig2_ICAM-1_like | 109..209 | CDD:143232 | 18/113 (16%) |
| Ig_2 | 217..281 | CDD:290606 | 17/83 (20%) | ||
| IG_like | 230..281 | CDD:214653 | 15/68 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||