| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 298 | Identity: | 64/298 - (21%) |
|---|---|---|---|
| Similarity: | 106/298 - (35%) | Gaps: | 117/298 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 SVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSS--TYKLQIKDIQETDAGTYTC 113
Fly 114 QVVISTVHKVS---------------------------AEVKLS-VRRPPVISDNSTQSVVASEG 150
Fly 151 SEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDR 215
Fly 216 RNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATA 280
Fly 281 DEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 21/109 (19%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | 64/298 (21%) | ||
| CDR1 | 51..59 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 4/13 (31%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 6/32 (19%) | ||
| Ig strand D | 84..90 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 94..102 | CDD:409353 | 1/9 (11%) | ||
| Ig strand F | 108..115 | CDD:409353 | 1/6 (17%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 2/32 (6%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/32 (6%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/73 (27%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 17/90 (19%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
| leucine-rich repeat | 69..89 | CDD:275380 | |||
| LRR_8 | 112..172 | CDD:290566 | |||
| leucine-rich repeat | 114..137 | CDD:275378 | |||
| leucine-rich repeat | 138..161 | CDD:275378 | |||
| LRR_8 | 160..214 | CDD:290566 | 11/41 (27%) | ||
| LRR_4 | 160..201 | CDD:289563 | 9/28 (32%) | ||
| leucine-rich repeat | 162..185 | CDD:275378 | 2/7 (29%) | ||
| leucine-rich repeat | 186..199 | CDD:275378 | 4/17 (24%) | ||
| leucine-rich repeat | 215..230 | CDD:275378 | 2/20 (10%) | ||
| Ig | 278..391 | CDD:299845 | 42/186 (23%) | ||
| I-set | 279..391 | CDD:254352 | 41/185 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||