| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
| Alignment Length: | 351 | Identity: | 100/351 - (28%) |
|---|---|---|---|
| Similarity: | 148/351 - (42%) | Gaps: | 56/351 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 ITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSS---- 94
Fly 95 ---TYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQME 156
Fly 157 CYASGYPTPTITWRRENNAILPTDSAT----YVGNT--LRIKSVKKEDRGTYYCVADNGVSKGDR 215
Fly 216 RNINVEVEFAPVITVPRPRLG----QALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISH 276
Fly 277 FATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQ-------AY 334
Fly 335 IAGAEDV--SATSFAL-VGILAALLF 357 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 24/101 (24%) |
| FR1 | 37..50 | CDD:409353 | 3/12 (25%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 12/37 (32%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/14 (21%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 134..208 | CDD:404760 | 28/79 (35%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 25/94 (27%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | 26/103 (25%) |
| FR1 | 38..54 | CDD:409353 | 5/16 (31%) | ||
| Ig strand A' | 39..45 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 47..55 | CDD:409353 | 2/7 (29%) | ||
| CDR1 | 55..59 | CDD:409353 | 1/13 (8%) | ||
| FR2 | 60..67 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 60..66 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 68..78 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 70..73 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 75..78 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 79..114 | CDD:409353 | 12/36 (33%) | ||
| Ig strand D | 83..90 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 93..99 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 106..114 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 115..119 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 119..128 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 121..128 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 131..206 | CDD:404760 | 28/79 (35%) | ||
| Ig strand A' | 138..143 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 149..156 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 162..167 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 173..175 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 185..191 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 198..205 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 212..220 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 223..302 | CDD:404760 | 24/85 (28%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 240..244 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 308..311 | CDD:409353 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||