| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001090640.1 | Gene: | igsf9 / 100036605 | XenbaseID: | XB-GENE-989817 | Length: | 1423 | Species: | Xenopus tropicalis |
| Alignment Length: | 349 | Identity: | 78/349 - (22%) |
|---|---|---|---|
| Similarity: | 119/349 - (34%) | Gaps: | 86/349 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 FDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLV------------------------------IKD 82
Fly 83 SRFSLRYDPN-------SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE------VKLSVRRP 134
Fly 135 PVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDR 199
Fly 200 GTYYCVA--DNG-VSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPP-AIVWT 260
Fly 261 K--DDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATN---RFGEAEARVNLF- 319
Fly 320 ---------ETIIPV-------CP 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 24/125 (19%) |
| FR1 | 37..50 | CDD:409353 | 1/1 (100%) | ||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | 1/2 (50%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
| CDR2 | 67..81 | CDD:409353 | 4/43 (9%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 1/31 (3%) | ||
| FR3 | 84..115 | CDD:409353 | 10/37 (27%) | ||
| Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
| CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
| FR4 | 124..130 | CDD:409353 | 1/11 (9%) | ||
| Ig strand G | 124..130 | CDD:409353 | 1/11 (9%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/75 (27%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 1/2 (50%) | ||
| Ig | 227..318 | CDD:416386 | 21/96 (22%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| igsf9 | NP_001090640.1 | Ig | 25..132 | CDD:299845 | 20/106 (19%) |
| IG_like | 25..110 | CDD:214653 | 16/84 (19%) | ||
| I-set | 136..222 | CDD:254352 | 24/89 (27%) | ||
| IGc2 | 151..212 | CDD:197706 | 18/60 (30%) | ||
| Ig_2 | 226..318 | CDD:290606 | 22/97 (23%) | ||
| I-set | 226..318 | CDD:254352 | 22/97 (23%) | ||
| IG_like | 328..407 | CDD:214653 | 5/17 (29%) | ||
| Ig | 340..402 | CDD:299845 | 2/5 (40%) | ||
| IG_like | 431..502 | CDD:214653 | |||
| Ig | 439..502 | CDD:299845 | |||
| FN3 | 507..601 | CDD:238020 | |||
| FN3 | 624..714 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||