| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001345491.5 | Gene: | LOC100006875 / 100006875 | -ID: | - | Length: | 718 | Species: | Danio rerio |
| Alignment Length: | 288 | Identity: | 65/288 - (22%) |
|---|---|---|---|
| Similarity: | 105/288 - (36%) | Gaps: | 53/288 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 LSTGST--LVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRP 134
Fly 135 PVISDNSTQSVVASEGSEVQMECYASGYPTPTITWR-----------RENNAILPTDSATYVGNT 188
Fly 189 ----------LRIKSVKKEDRGTYYCVADNGVSK-GDRR--------NINVEVEFAPVITVPRPR 234
Fly 235 LGQALQYDMDLECHIEAYPPPAIVWTKD--DIQLANNQHYSISHFATADEYTDSTLRVITVEKRQ 297
Fly 298 YGDYVCKATNRFGEAEARVNLFETIIPV 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 15/60 (25%) |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | 2/10 (20%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 65/288 (23%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 9/30 (30%) | ||
| Ig strand D | 84..90 | CDD:409353 | 3/5 (60%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 108..115 | CDD:409353 | 1/6 (17%) | ||
| CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
| FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 134..208 | CDD:404760 | 19/94 (20%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 187..191 | CDD:409353 | 2/13 (15%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 2/10 (20%) | ||
| Ig | 227..318 | CDD:416386 | 22/92 (24%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 1/4 (25%) | ||
| LOC100006875 | XP_001345491.5 | Ig | 44..124 | CDD:299845 | |
| Ig | 155..248 | CDD:299845 | |||
| Ig | 299..385 | CDD:299845 | 15/55 (27%) | ||
| IG_like | 394..486 | CDD:214653 | 21/99 (21%) | ||
| Ig | 409..494 | CDD:299845 | 23/92 (25%) | ||
| Ig | 517..597 | CDD:299845 | 21/83 (25%) | ||
| IG_like | 600..702 | CDD:214653 | 65/288 (23%) | ||
| Ig | 619..700 | CDD:299845 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||