DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lac and vsig10

DIOPT Version :9

Sequence 1:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001093564.2 Gene:vsig10 / 100005564 ZFINID:ZDB-GENE-030131-7476 Length:529 Species:Danio rerio


Alignment Length:391 Identity:88/391 - (22%)
Similarity:131/391 - (33%) Gaps:119/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WSTLLLAIFVQQTLAQRTPTISYITQEQIKDI---------------GGTVEFDCSVQYAKEYNV 60
            |.||..   :|.|:|.....:|.       ||               |..|.|.||.:.....|:
Zfish   106 WQTLSK---IQLTIAAGPTGVSL-------DISPATFLNNGTLFVHKGSNVNFSCSSESNPSQNL 160

  Fly    61 LF----LKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVH 121
            .:    |.:|:             .:..|.     :.|.....|.:||..|.|||||        
Zfish   161 TWTVDNLASDN-------------PEREFG-----SKSPLAFSITNIQPLDQGTYTC-------- 199

  Fly   122 KVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMEC----------------YASGYPTPTITWR 170
              :::..||.|     :.|.||.::.....|...||                :..|||.||:||:
Zfish   200 --TSQNTLSRR-----TANKTQELLVYYAPERHPECSWELGDKPSDVLFICSWFGGYPVPTLTWQ 257

  Fly   171 R-ENNAILPTDSATYVGNTLRIK-SVKK---EDRGTYYCVADNGVSKGDRRNINVEVEFAPVITV 230
            . |..|..||.:.|....|..:. ||.:   .|.....|...:..        .||...:..:.:
Zfish   258 EVEGAAEGPTINLTTSQQTEELNVSVNRSILHDGDKVKCTGHHVT--------GVEKSCSFTLKI 314

  Fly   231 PRPR---LGQALQ-YDMDLEC-HIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRV 290
            |.|.   |..||: .::.:.| ...:.||...||.|:|..:.|...|.:.....|     .||.:
Zfish   315 PYPTGQPLATALEGTNITISCTETSSLPPAKTVWKKNDDLIENTSKYIVQENRPA-----LTLTI 374

  Fly   291 ITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAAL 355
            :.|.|...|.|.|.:.|..|..|..|.|                  ..:..:....|:|||..::
Zfish   375 VNVTKADEGVYYCYSENPLGARELEVYL------------------NVKTSAGNGGAIVGIFVSV 421

  Fly   356 L 356
            |
Zfish   422 L 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 22/113 (19%)
FR1 37..50 CDD:409353 5/27 (19%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/7 (14%)
FR2 60..63 CDD:409353 0/6 (0%)
CDR2 67..81 CDD:409353 0/13 (0%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/30 (37%)
Ig strand D 84..90 CDD:409353 1/5 (20%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 5/6 (83%)
CDR3 116..124 CDD:409353 0/7 (0%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 23/94 (24%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 1/4 (25%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 26/95 (27%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
vsig10NP_001093564.2 IG_like 28..116 CDD:214653 4/12 (33%)
Ig 32..104 CDD:299845
IG_like 140..204 CDD:214653 19/91 (21%)
IGc2 143..203 CDD:197706 19/87 (22%)
IG_like 324..404 CDD:214653 24/102 (24%)
Ig 328..404 CDD:299845 22/98 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.