| Sequence 1: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005157551.1 | Gene: | dscaml1 / 100002762 | -ID: | - | Length: | 2158 | Species: | Danio rerio |
| Alignment Length: | 399 | Identity: | 103/399 - (25%) |
|---|---|---|---|
| Similarity: | 138/399 - (34%) | Gaps: | 127/399 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 RTP-TISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYD 90
Fly 91 PNSSTYKLQIKDIQETDA-GTYTCQVVISTVHKVSAE------VKLSVRRP----PVISDNSTQS 144
Fly 145 VVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSA-TYVGNTLRIKSVKKEDRGTYYCVADN 208
Fly 209 GV-SKGDRRNINV-------------------------EVEFAPVITVP---------------- 231
Fly 232 ------------------------RPRLGQALQ--------------------------YDMDLE 246
Fly 247 CHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGE 311
Fly 312 AE--ARVNL 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 28/101 (28%) |
| FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 1/6 (17%) | ||
| CDR1 | 51..59 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 13/31 (42%) | ||
| Ig strand D | 84..90 | CDD:409353 | 3/5 (60%) | ||
| Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 116..124 | CDD:409353 | 3/7 (43%) | ||
| FR4 | 124..130 | CDD:409353 | 2/11 (18%) | ||
| Ig strand G | 124..130 | CDD:409353 | 2/11 (18%) | ||
| Ig_3 | 134..208 | CDD:404760 | 29/78 (37%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 33/158 (21%) | ||
| Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| dscaml1 | XP_005157551.1 | IG_like | 112..184 | CDD:214653 | |
| Ig | 112..183 | CDD:143165 | |||
| Ig | 194..287 | CDD:299845 | 30/110 (27%) | ||
| I-set | 302..380 | CDD:254352 | 28/78 (36%) | ||
| IGc2 | 309..370 | CDD:197706 | 24/61 (39%) | ||
| IGc2 | 399..458 | CDD:197706 | 4/58 (7%) | ||
| I-set | 477..571 | CDD:254352 | 27/93 (29%) | ||
| Ig | 477..567 | CDD:299845 | 25/89 (28%) | ||
| IG_like | 581..662 | CDD:214653 | |||
| IGc2 | 588..646 | CDD:197706 | |||
| Ig | 684..751 | CDD:143165 | |||
| IG_like | 686..756 | CDD:214653 | |||
| I-set | 760..855 | CDD:254352 | |||
| Ig7_DSCAM | 778..855 | CDD:143211 | |||
| IG_like | 865..956 | CDD:214653 | |||
| Ig | 873..963 | CDD:299845 | |||
| FN3 | 959..1053 | CDD:238020 | |||
| FN3 | 1060..1157 | CDD:238020 | |||
| FN3 | 1165..1271 | CDD:238020 | |||
| FN3 | 1276..1367 | CDD:238020 | |||
| IGc2 | 1392..1455 | CDD:197706 | |||
| FN3 | 1486..1559 | CDD:238020 | |||
| FN3 | 1573..1649 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||