DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyb and TUSC1

DIOPT Version :9

Sequence 1:NP_001097287.1 Gene:Dyb / 36362 FlyBaseID:FBgn0033739 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001004125.2 Gene:TUSC1 / 286319 HGNCID:31010 Length:209 Species:Homo sapiens


Alignment Length:218 Identity:57/218 - (26%)
Similarity:74/218 - (33%) Gaps:66/218 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 SGLVHGHHGPHPGLPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASANDEEHRLIAR 405
            ||...|...|..| .|..|...|:.....:...|..|.|:       |.:.|..|.||..    |
Human    29 SGRARGGGSPSGG-GGGVGWRGRADGARQQLEERFADLAA-------SHLEAIRARDEWD----R 81

  Fly   406 YAARLAQENRAPSNLPDNATPIGTDNSRAQRELIAQLESKNKEIMREIARL------------RR 458
            ..|||.|||          ..:..:|.|.:||        |:.:.|:..||            ||
Human    82 QNARLRQEN----------ARLRLENRRLKRE--------NRSLFRQALRLPGEGGNGTPAEARR 128

  Fly   459 QQE---TEQMA--------PENPALINELRALRQRKGELEGHLGALQDSRRQLME-QLEGLMRML 511
            ..|   |.:.|        |.:|      ||||.|..:||...      ||.|:: .||......
Human   129 VPEEASTNRRARDSGREDEPGSP------RALRARLEKLEAMY------RRALLQLHLEQRGPRP 181

  Fly   512 KNQQTASPRSTPNSSPRSGKSPP 534
            ...:...|...|:|..||..|.|
Human   182 SGDKEEQPLQEPDSGLRSRDSEP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DybNP_001097287.1 EF-hand_2 7..131 CDD:286194
EF-hand_3 135..223 CDD:286195
ZZ_dystrophin 232..280 CDD:239074
Ribosomal_L29 436..482 CDD:279204 17/68 (25%)
TUSC1NP_001004125.2 MreC 61..>115 CDD:418554 22/82 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.