DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUBAI and Usp12-46

DIOPT Version :9

Sequence 1:NP_610784.1 Gene:DUBAI / 36361 FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster


Alignment Length:417 Identity:113/417 - (27%)
Similarity:185/417 - (44%) Gaps:58/417 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 GLVNLGNTCYMNSVLQALAMTSDFSRQIL------------LIECNSVLLMKVQQQIALMHHSLR 411
            ||||.|||||.|||||||.....|..::|            |:.|.:.|...:..|...:.    
  Fly    25 GLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETLLSCLADLFYSIATQKKKVG---- 85

  Fly   412 YELTPSRVLNATR--PPSFTPGLQQDSSEFLGYLLDLLHEHEINSSSVTGHSVGPPKTGREVDDV 474
             .:.|.:.:...|  ...|...:|||:.|||.:|::.::| .|.:....|.|.|.||...:....
  Fly    86 -SIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLINHINE-IILAERNAGPSNGNPKATNQGGST 148

  Fly   475 PALLSEDILSSGVIPYNSKDHELSSGSNSDNCNHKP--------------TPTPPATPTKATNGL 525
            .|:.| .|.|......||..:..|:.:::.|.::..              :.|...||..:.||.
  Fly   149 SAMAS-SIASKSSSTSNSNSNSNSTTNSNGNSSNSTGSLNANTSVLDASGSLTATTTPIISGNGT 212

  Fly   526 KQQGQQVDQAKPPSTIDKTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQ 590
            ...|...:    |:.:.:.|.|.|::..|||||...|..:::|.:||:....        |.|:.
  Fly   213 GTNGANSE----PTWVHEIFQGILTSETRCLNCETVSSKDENFFDLQVDVDQ--------NTSIT 265

  Fly   591 DLIEYYCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKV 655
            ..:..:.:.|.|..||::.|..|....:|::.:.|.:.|..|.|.||:|||.::::...|:.|:|
  Fly   266 HCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRV 330

  Fly   656 FHDESVTVKMSAKDSLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTH-- 718
            .....:.:..::.|::.....  |||.|.|:|.|...:.|||.:....... |..|:|::|..  
  Fly   331 VFPLELRLFNTSDDAVNPDRL--YDLTAVVIHCGSGPNRGHYISIVKSHGL-WLLFDDDMVDKIE 392

  Fly   719 -SKPEEMHNLT-----SPNTPYILFYK 739
             |..|:.:.||     |..|.|||||:
  Fly   393 ASTIEDFYGLTSDIHKSSETGYILFYQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUBAINP_610784.1 UCH 358..738 CDD:278850 111/414 (27%)
Peptidase_C19H 359..739 CDD:239129 112/415 (27%)
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 112/415 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D83176at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.