DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUBAI and Usp2

DIOPT Version :9

Sequence 1:NP_610784.1 Gene:DUBAI / 36361 FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster


Alignment Length:516 Identity:126/516 - (24%)
Similarity:201/516 - (38%) Gaps:125/516 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 AAPVVFHMLSTINQTPEVFHKILPRIPRVLQYVKNQSTTMDEIGLETKKCLQQLVDLTSALMLRF 314
            |||         |...:...:.|.|.|        .|:|:...|..:....:.::...:....|:
  Fly   532 AAP---------NSASDSVSRSLARSP--------ISSTLARSGTGSSSTARSVLPPMTPTSSRY 579

  Fly   315 YDQD----ELYVATKKALQTYEPSPNCVALAKAMHENAQPWGRRNARVGLVNLGNTCYMNSVLQA 375
            :|:|    ...:.|..||.:.....|.....|....:...  :.....||.|:||||:||||:|.
  Fly   580 WDRDSGTSRSSIGTSSALNSSSLKHNSDDGYKTASSSRDE--KSEGLCGLRNIGNTCFMNSVIQC 642

  Fly   376 LAMTSDFSRQILLIECNSVLLMKVQQQIALMHHSLR----------YELTPSRVLNA--TRPPSF 428
            |:.|.:.:|.:.....:..|..|.||   ::|...:          :.:||..:..|  |:...:
  Fly   643 LSHTQELTRFLRSHHGSRSLSTKDQQ---ILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMY 704

  Fly   429 TPGLQQDSSEFLGYLLDLLHEHEINSSSVTGHSVGPPKTGREVDDVPALLSEDILSSGVIPYNSK 493
            :...|||:.|||.:.||.||                                ..|:|||     |
  Fly   705 SDYNQQDAQEFLRFFLDSLH--------------------------------SALNSGV-----K 732

  Fly   494 DHELSSGSN-SDNCNHKPTPTPPATPTKATNGLKQQGQQVDQAKPPSTIDKTFAGKLSTTYRCLN 557
            ...|:...| |||   |.........|:..|.|               :...|.|:|.:|.:|..
  Fly   733 GETLNIDDNLSDN---KKADLTWEWYTRHENSL---------------VRDLFVGQLKSTLKCTT 779

  Fly   558 CGWESRNEDSFRELQLSFPDDKEDCGATNYSVQDLIEYYCSPEKLDGDNQYFCPQCKKLCDAERH 622
            ||..|...|.|.:|.:..|      .::...::..::.:...|.||||....|.:||......:.
  Fly   780 CGNTSVTFDPFWDLSVPLP------SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKS 838

  Fly   623 IGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHDESVTVKMSAKDSLQEM--------STVHY 679
            ..:.:.||.|::.||:|. :.::   :||        |..|:....||...|        |.|||
  Fly   839 FTIQRFPKYLVIHLKRFS-ETRW---SKL--------SNIVEFPTSDSELNMGSYGANSNSNVHY 891

  Fly   680 DLYAGVVHAGYSMDSGHYFTFAADQ-AKNWYKFNDNVVTHSKPEEMHNLTSPNTPYILFYK 739
            .|||...|.| |...|||....... ::.|::||||:|:.:..|  ::|.| ::.|||||:
  Fly   892 SLYAISNHMG-STAGGHYVALCKHPVSRKWHEFNDNIVSDALSE--NHLVS-SSAYILFYE 948

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUBAINP_610784.1 UCH 358..738 CDD:278850 106/401 (26%)
Peptidase_C19H 359..739 CDD:239129 107/401 (27%)
Usp2NP_001285528.1 UCH 624..947 CDD:278850 106/402 (26%)
Peptidase_C19R 626..948 CDD:239139 107/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.