DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUBAI and usp12b

DIOPT Version :9

Sequence 1:NP_610784.1 Gene:DUBAI / 36361 FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_001106637.1 Gene:usp12b / 100127879 XenbaseID:XB-GENE-5749343 Length:369 Species:Xenopus tropicalis


Alignment Length:412 Identity:110/412 - (26%)
Similarity:164/412 - (39%) Gaps:116/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 GLVNLGNTCYMNSVLQALAMTSDFSRQIL-----------LIEC-----NSVLLMKVQQQIALMH 407
            ||||.|||||.|||||||.....|..::|           |:.|     ||:...|.:..:    
 Frog    40 GLVNFGNTCYCNSVLQALYFCRPFREKVLAYKVQPRKKESLLTCLADLFNSIATQKKKVGV---- 100

  Fly   408 HSLRYELTPSRVLNATRPPS--FTPGLQQDSSEFLGYLLDLLHEHEINSSSVTGHSVGPPKTGRE 470
                  :.|.:.::..|..:  |...:|||:.|||.|||:.:.:                     
 Frog   101 ------IPPKKFISRLRKENELFDNYMQQDAHEFLNYLLNTIAD--------------------- 138

  Fly   471 VDDVPALLSEDILSSGVIPYNSKDHELSSGSNSDNCNHKPTPTPPATPTKATNGLKQQGQQVDQA 535
                  ||.|:           :..|..:|                   |..||..       :|
 Frog   139 ------LLLEE-----------RKQEKQNG-------------------KLQNGTL-------EA 160

  Fly   536 KPPSTIDKT-----FAGKLSTTYRCLNCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQDLIEY 595
            ..|...|.|     |.|.|:...|||||...|..::.|.:|.:    |.|.    |.|:...:..
 Frog   161 PEPEKSDLTWVHEIFQGTLTNETRCLNCEAVSSKDEDFLDLSV----DVEQ----NTSITHCLRG 217

  Fly   596 YCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHDES 660
            :.:.|.|..:.:|:|.||:...:|::.:.|.:.|..|.|.||:|||..:.|..|||.::|.....
 Frog   218 FSNTETLCSEYKYYCEQCRSKQEAQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLE 282

  Fly   661 VTVKMSAKDSLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTH---SKPE 722
            :.:..::.|:......  |||.|.|||.|...:.|||.|...... .|..|:|::|..   ...|
 Frog   283 LRLFNTSGDATNPDRM--YDLVAVVVHCGSGPNRGHYITIVKSHG-FWLLFDDDIVEKIDAQAIE 344

  Fly   723 EMHNLTS-----PNTPYILFYK 739
            |.:.|||     ..:.|||||:
 Frog   345 EFYGLTSDISKNSESGYILFYQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUBAINP_610784.1 UCH 358..738 CDD:278850 108/409 (26%)
Peptidase_C19H 359..739 CDD:239129 109/410 (27%)
usp12bNP_001106637.1 Peptidase_C19G 40..366 CDD:239128 109/410 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.