DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8834 and Slc27a3

DIOPT Version :9

Sequence 1:NP_610779.1 Gene:CG8834 / 36356 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001099909.1 Gene:Slc27a3 / 295219 RGDID:1310605 Length:667 Species:Rattus norvegicus


Alignment Length:441 Identity:94/441 - (21%)
Similarity:157/441 - (35%) Gaps:128/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FCDGQEYDKVHKATVGWHPEILTLTDHVEGVQGIETLLDPTTTEKIYQPEVLKEGGDQTVAILC- 195
            |.:..|.|......:|.|   |..|.....:.||..||....|: :.:|........|.:...| 
  Rat   208 FLESLEPDLPALRAMGLH---LWATGPGTNLAGISNLLSEAATQ-VDEPVPGYLSAPQNIMDTCL 268

  Fly   196 ---SSGTTGLPKAVCISNSILIQDSML-----ITSQSVIYVGSCLDWITG-LWAFVFSTVFGCTR 251
               :|||||||||..:|:..::|....     :..:.|||:...|..::| |...|.....|.|.
  Rat   269 YIFTSGTTGLPKAARVSHLKVLQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCLGIGATV 333

  Fly   252 IISNKAFTPEY-------------FVGLVKKYKINYAVLPPR-----HLSALITCPDAKPDA--- 295
            ::..|....::             ::|.:.:|.:|.   ||.     |...|......:||.   
  Rat   334 VLKPKFSASQFWEDCQRHGVTVFQYIGELCRYLVNQ---PPSKAECGHKVRLAVGSGLRPDTWDR 395

  Fly   296 ----LAPITHLNYGGGSISLATLQRSQELCKTAMFNSGYGMTEVGAITINI-----GISNVS--- 348
                ..|:                   ::.:|      ||.||....|.|.     .:...|   
  Rat   396 FVRRFGPL-------------------QILET------YGATEGNVATFNYTGQQGAVGRASWLY 435

  Fly   349 -------------SAGRPV--------------PGIKIRIVDEDGKSLGYNQVGEIYVHTGQAWN 386
                         ..|.|:              ||:.:..|.::...|||....|:         
  Rat   436 KHIFPFSLIRYDVMTGEPIRNAQGHCMAASPGEPGLLVAPVSQESPFLGYAGAPEL--------- 491

  Fly   387 GYYGNPVETRRMQDF----EGWFHTGDLGYFDEQNFLYIVDRKKEILKYNGLHYWPTEIETVIAE 447
                  .:.:.::|.    :.:|:||||...|||.||:..||..:..::.|.:...||:..|:..
  Rat   492 ------AQEKLLKDVFRPGDIFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVATTEVAEVLEA 550

  Fly   448 LSQVQDVCVVGI----YDEREGDAAGALVVKSKGATISAKEIVEHVAKRLP 494
            |..:|:|.:.|:    ::.|.|.||.||   .....:...::..||::.||
  Rat   551 LDFLQEVNIYGVTVPGHEGRAGMAALAL---RPPQALDLVQLYTHVSENLP 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8834NP_610779.1 CaiC 20..529 CDD:223395 94/441 (21%)
AFD_class_I 46..519 CDD:302604 94/441 (21%)
Slc27a3NP_001099909.1 PRK08279 60..666 CDD:236217 94/441 (21%)
AFD_class_I 91..657 CDD:302604 94/441 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.