DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8834 and ACSF3

DIOPT Version :9

Sequence 1:NP_610779.1 Gene:CG8834 / 36356 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:559 Identity:129/559 - (23%)
Similarity:224/559 - (40%) Gaps:124/559 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TFEQGLTWSIRIAQYLKK------RGLNHKDVIGIAAKNSTYVMPLGVACLMNG--TPFHSVNPV 113
            |:.:..:.|:|::|.:.:      ..|..:.|..:.|.:::||:....:.:..|  .|.:..:|.
Human    67 TYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHPA 131

  Fly   114 LDDATLTHVFSITKPTLIFCDGQEYDKVHKATVGWHPEILTLTDHVEGVQGIETL-LDPTT-TEK 176
               |.|.:|         .||.|      .:.|....|.|.|...|....|:..| |.|.. |..
Human   132 ---AQLEYV---------ICDSQ------SSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGA 178

  Fly   177 IYQP-EV-LKEGG--DQTVAILCSSGTTGLPKAVCISNSILIQDSMLITSQSVIYVGSCLDWITG 237
            :.:| || :.|.|  ::...|:.:|||||.||.|            |.|.|::..|      :||
Human   179 VEEPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGV------------LSTHQNIRAV------VTG 225

  Fly   238 L---WAFVFSTVF----------------------GCTRIISNKAFTPEYFVGLVKKY------K 271
            |   ||:....|.                      |.|.::..: |:|:.   :.:|:      :
Human   226 LVHKWAWTKDDVILHVLPLHHVHGVVNALLCPLWVGATCVMMPE-FSPQQ---VWEKFLSSETPR 286

  Fly   272 INYAVLPPRHLSALI-------TCPDAKPDALAPITH-----LNYGGGSISLATLQRSQELCKTA 324
            ||..:..|...:.|:       |.|.|: |.|..:..     :..|..::.|..|::.:.:....
Human   287 INVFMAVPTIYTKLMEYYDRHFTQPHAQ-DFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHT 350

  Fly   325 MFNSGYGMTEVG-AIT--INIGISNVSSAGRPVPGIKIRIV-----------------DEDGKSL 369
            :... |||||:| |::  :...:....|.|.|:||:::|||                 ||.|..:
Human   351 LLER-YGMTEIGMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKV 414

  Fly   370 --GYNQ-VGEIYVHTGQAWNGYYGNPVETRRMQDFEGWFHTGDLGYFDEQNFLYIVDRKKEILKY 431
              |:.: .||:.|.....:..|:..|.||:.....:|||.|||...|.:..:........:|:|.
Human   415 TPGFEEKEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKT 479

  Fly   432 NGLHYWPTEIETVIAELSQVQDVCVVGIYDEREGDAAGALVVKSKGATISAKEIVEHVAKRLPAT 496
            .|......|:|..:.....:.||.|:|:.|...|....|:|...:|.::|.:|:.|....:...|
Human   480 GGYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARLKEHPT 544

  Fly   497 QKQLRAGVQFTDK--LPANVNGKTMRKTARDVFVALRVS 533
            :::..:.:....|  |.:.:...|.|..||...|:..||
Human   545 KRRENSILNIGRKRNLASGMRALTGRMAARRAAVSSEVS 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8834NP_610779.1 CaiC 20..529 CDD:223395 126/553 (23%)
AFD_class_I 46..519 CDD:302604 122/543 (22%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 120/520 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.