DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8834 and SLC27A3

DIOPT Version :9

Sequence 1:NP_610779.1 Gene:CG8834 / 36356 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_077306.3 Gene:SLC27A3 / 11000 HGNCID:10997 Length:683 Species:Homo sapiens


Alignment Length:421 Identity:91/421 - (21%)
Similarity:147/421 - (34%) Gaps:127/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GWHPEILTLTDHVEGVQGIETLLDPTTTE-------KIYQPEVLKEGGDQTVAILCSSGTTGLPK 204
            |.||            .||..||...:.|       .:..|:.:.:    |...:.:||||||||
Human   248 GTHP------------AGISDLLAEVSAEVDGPVPGYLSSPQSITD----TCLYIFTSGTTGLPK 296

  Fly   205 AVCISNSILIQDSML-----ITSQSVIYVGSCLDWITG-LWAFVFSTVFGCTRIISNKAFTPEY- 262
            |..||:..::|....     :..:.|||:...|..::| |...|.....|.|.::.:|....:: 
Human   297 AARISHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFW 361

  Fly   263 ------------FVGLVKKYKINYAVLPPR-----HLSALITCPDAKPDALAPITHLNYGGGSIS 310
                        ::|.:.:|.:|.   ||.     |...|......:||                
Human   362 EDCQQHRVTVFQYIGELCRYLVNQ---PPSKAERGHKVRLAVGSGLRPD---------------- 407

  Fly   311 LATLQRSQELCKTAMFNSGYGMTEVGAITINI-----GISNVS----------------SAGRPV 354
              |.:|.............||:||....|||.     .:...|                :.|.|:
Human   408 --TWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPI 470

  Fly   355 --------------PGIKIRIVDEDGKSLGYNQVGEIYVHTGQAWNGYYGNP--VETRRMQDF-- 401
                          ||:.:..|.:....|                 ||.|.|  .:.:.::|.  
Human   471 RDPQGHCMATSPGEPGLLVAPVSQQSPFL-----------------GYAGGPELAQGKLLKDVFR 518

  Fly   402 --EGWFHTGDLGYFDEQNFLYIVDRKKEILKYNGLHYWPTEIETVIAELSQVQDVCVVGI-YDER 463
              :.:|:||||...|:|.||...||..:..::.|.:...||:..|...|..:|:|.|.|: ....
Human   519 PGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGH 583

  Fly   464 EGDAAGALVVKSKGATISAKEIVEHVAKRLP 494
            ||.|..|.:|......:...::..||::.||
Human   584 EGRAGMAALVLRPPHALDLMQLYTHVSENLP 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8834NP_610779.1 CaiC 20..529 CDD:223395 91/421 (22%)
AFD_class_I 46..519 CDD:302604 91/421 (22%)
SLC27A3NP_077306.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..145
hsFATP2a_ACSVL_like 163..673 CDD:213304 91/421 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.