DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8834 and SLC27A5

DIOPT Version :9

Sequence 1:NP_610779.1 Gene:CG8834 / 36356 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_036386.1 Gene:SLC27A5 / 10998 HGNCID:10999 Length:690 Species:Homo sapiens


Alignment Length:456 Identity:101/456 - (22%)
Similarity:173/456 - (37%) Gaps:77/456 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 MPLGVACLMNGTPFHSVNPVLDDATLTHVFSITKPTLIFCDGQEYDKVHKATVGWHPE-----IL 153
            |.||:|.|  |.|...:||......|.|....:...::..|....:.:.:.......|     .|
Human   190 MWLGLAKL--GCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILPKLQAENIRCFYL 252

  Fly   154 TLTDHVEGVQGIETLLDPTTTEKIYQPEVLKEG--GDQTVAILCSSGTTGLPKAVCISNSILIQD 216
            :.|....||..:...||...:..:  |..|:.|  .......:.:||||||||...:::..::|.
Human   253 SHTSPTPGVGALGAALDAAPSHPV--PADLRAGITWRSPALFIYTSGTTGLPKPAILTHERVLQM 315

  Fly   217 SMLI-----TSQSVIYVGSCLDWITGLWAFVFSTV-FGCTRIISNKAFTPEYFVGLVKKYKINYA 275
            |.::     |:..|:|....|..:.||...:...: .|.|.:::.| |:...|....:::.:...
Human   316 SKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAPK-FSTSCFWDDCRQHGVTVI 379

  Fly   276 VLPPRHLSALITCPDAKPDALAPITHLNYGGGSISLATLQRSQELCKTAMFNSGYGMTEVGAITI 340
            :.....|..|...|. :|:.......|..|.| :.....:..|:..........||.||.     
Human   380 LYVGELLRYLCNIPQ-QPEDRTHTVRLAMGNG-LRADVWETFQQRFGPIRIWEVYGSTEG----- 437

  Fly   341 NIGISNV--------------------------SSAGRPVPGIKIRIVDEDGKSL--GYNQVGEI 377
            |:|:.|.                          ..|..||.       |..|..:  |..:.|.:
Human   438 NMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVR-------DNQGFCIPVGLGEPGLL 495

  Fly   378 Y--VHTGQAWNGYYG-NPVETRRM-----QDFEGWFHTGDLGYFDEQNFLYIVDRKKEILKYNGL 434
            .  |.:.|.:.||.| ..:..|::     |..:.:::|||:...|.:.|||..||..:..::.|.
Human   496 LTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGE 560

  Fly   435 HYWPTEIETVIAELSQVQD-----VCVVGIYDEREGDAAGALVVKSKGATISAKEIVEHVAKRLP 494
            :....|:|.|::::..:|.     |||.|.    ||....|.|..:.|.|...:::.:||...||
Human   561 NVSTHEVEGVLSQVDFLQQVNVYGVCVPGC----EGKVGMAAVQLAPGQTFDGEKLYQHVRAWLP 621

  Fly   495 A 495
            |
Human   622 A 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8834NP_610779.1 CaiC 20..529 CDD:223395 101/456 (22%)
AFD_class_I 46..519 CDD:302604 101/456 (22%)
SLC27A5NP_036386.1 PRK08279 87..690 CDD:236217 101/456 (22%)
hsFATP2a_ACSVL_like 140..680 CDD:213304 101/456 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.