DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr65Ax2

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:84 Identity:29/84 - (34%)
Similarity:41/84 - (48%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIIKYNKEQSDDG--SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQ 114
            |.::..:..|:.|  :|....||.:.....|.|.||:..|....:.. ||.:||..|:|....|.
  Fly    18 PTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIST-HGSFSYVGPDGQTYTVT 81

  Fly   115 YTADENGFRATGDHIPTPP 133
            |.||||||:..|.|:|..|
  Fly    82 YVADENGFQPQGAHLPVAP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/55 (36%)
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.