powered by:
Protein Alignment Cpr49Ah and Lcp65Ab2
DIOPT Version :9
Sequence 1: | NP_610777.1 |
Gene: | Cpr49Ah / 36354 |
FlyBaseID: | FBgn0033731 |
Length: | 190 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788469.1 |
Gene: | Lcp65Ab2 / 48381 |
FlyBaseID: | FBgn0020643 |
Length: | 104 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 21/69 - (30%) |
Similarity: | 36/69 - (52%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 YKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSY-QSPEGTLVNVQYTADENGFRATGDHI 129
:.::.||.:....::.|.||:..|: |...|.||.::: ....|....:.|.|||||::..|.|:
Fly 35 WSSDVETSDGTSIKQEGVLKNAGTD-NEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHL 98
Fly 130 PTPP 133
|..|
Fly 99 PVAP 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.