DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC4578365

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_001238131.2 Gene:LOC4578365 / 4578365 VectorBaseID:AGAMI1_013645 Length:124 Species:Anopheles gambiae


Alignment Length:141 Identity:34/141 - (24%)
Similarity:56/141 - (39%) Gaps:41/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVLILLVLL-AISCQGQHHHQHQHQNVNNIPRDDKPDHHRHEDHRETSTWIPI-IKYNKEQSDDG 64
            |::::|.|: |:|.|..:.||..:|          |.|:.||:....    |: .:|:.:..|| 
Mosquito     4 KIIVVLALVAAVSAQSHYGHQQHYQ----------PQHYHHEEEHHG----PVHYEYHYDVHDD- 53

  Fly    65 SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTAD-ENGFRA---- 124
                  .||:  :|.:....||..|        .|:|.....:|....|.|..: ::||.|    
Mosquito    54 ------HTGD--VHGQKEARKDDST--------QGEYYLIDADGHKRTVTYHVEGKSGFIAEVHR 102

  Fly   125 ---TGDHIPTP 132
               .|...|.|
Mosquito   103 EPIKGYQAPQP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 11/56 (20%)
LOC4578365XP_001238131.2 None

Return to query results.
Submit another query.