DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:73 Identity:24/73 - (32%)
Similarity:39/73 - (53%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QSDDG--SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGF 122
            :||.|  :::..:||.:.......|.||..:|:...:.|| |.:.:.:.:|....|.|.||||||
  Fly    25 ESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQ-GSFRFVADDGQTYEVNYIADENGF 88

  Fly   123 RATGDHIP 130
            :..|.|:|
  Fly    89 QPQGAHLP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 16/55 (29%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.