DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and CG15515

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:70 Identity:24/70 - (34%)
Similarity:35/70 - (50%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQY-SYQSPEGTLVNVQYTADE 119
            ||:..:.:| |:...|..|....||.|.:.:..| |:..||..|.| ||.....|.....||||:
  Fly    37 YNQAPTKEG-YRFASEEPNGSKREEMGVIMNPGT-PDEQLVVMGMYSSYDEKTDTETVTMYTADK 99

  Fly   120 NGFRA 124
            :|::|
  Fly   100 DGYKA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/56 (34%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.