DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and CG8927

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:135 Identity:32/135 - (23%)
Similarity:46/135 - (34%) Gaps:49/135 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QGQHHHQHQHQNVNNIPRDDKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTE---------- 69
            |.|..|..|.|.....|........|.|:...:.||       ..::||||:|.|          
  Fly   241 QLQDDHVDQQQQRRRQPVSQTIRKWREENEDGSITW-------GYENDDGSFKEELIGTDCITKG 298

  Fly    70 ---------------YETG---------NSIIHEETGFLKDFDTN----PNGV---LVQHGQYSY 103
                           ||||         |....:|.||: :::.|    |||:   :.|.|:...
  Fly   299 TYGYVDPDGNKREYHYETGIKCDPNNRNNEEELQENGFV-NYEENRAVLPNGLEIDMTQLGKKKS 362

  Fly   104 QSPEG 108
            :.|.|
  Fly   363 KRPNG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 18/84 (21%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 12/58 (21%)

Return to query results.
Submit another query.