DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:40/86 - (46%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PII-KYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQY 115
            |:: |..:|......||..|:..:|:..:....:::.|.:     |..|:||....:|....|||
  Fly    47 PVLAKAAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGD-----VVRGEYSLIDADGYKRTVQY 106

  Fly   116 TADE-NGFRATGDHIPTPPAI 135
            |||. |||.|..:..|...|:
  Fly   107 TADPINGFNAVVNREPLVKAV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 17/56 (30%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 17/56 (30%)

Return to query results.
Submit another query.