DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr67Fb

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:107 Identity:46/107 - (42%)
Similarity:58/107 - (54%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSP 106
            |...||:      ||..|...||||..||.|.|.|..:|:|.         |.:...|..||.:|
  Fly    21 ESQAETT------KYRNEIKPDGSYSWEYGTSNGIDAQESGV---------GGVQAAGSVSYAAP 70

  Fly   107 EGTLVNVQYTADENGFRATGDHIPTPPAIPEEIQKGLDQIYA 148
            :||.:.::|||||||:|.||.|:||||.||:.|.|.|..|.|
  Fly    71 DGTPIQLEYTADENGYRPTGAHLPTPPPIPDYILKALAYIEA 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 21/55 (38%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.