DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:94 Identity:39/94 - (41%)
Similarity:49/94 - (52%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTA 117
            |.|:...|..||:|..:.|..:.|..:|.| |...:.        ||.|||.||||..|.|.|||
  Fly    24 ITKFLANQDTDGTYAYDIEQASGIQIKEEG-LAGHEA--------HGSYSYISPEGIPVQVVYTA 79

  Fly   118 DENGFRATGDHIPTPPAIPEEIQKGLDQI 146
            ||.||....:.:||||.|||||.:.:..|
  Fly    80 DEFGFHPQSNLLPTPPPIPEEILRSIRYI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 22/55 (40%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 22/55 (40%)

Return to query results.
Submit another query.