DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:81 Identity:29/81 - (35%)
Similarity:43/81 - (53%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTA 117
            |::...:...:| |....||.:...|||.|.||:..|....::|: |.||:.:.:|....|.|.|
  Fly    28 ILRLESDVQPEG-YNFALETSDGKKHEEQGQLKNVGTEQEAIVVR-GSYSFVADDGQTYTVNYIA 90

  Fly   118 DENGFRATGDHIPTPP 133
            |||||:..|.|:|..|
  Fly    91 DENGFQPEGAHLPNVP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 21/55 (38%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.