DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:114 Identity:43/114 - (37%)
Similarity:58/114 - (50%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RHEDHR-------ETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKD----------- 86
            |.:|.|       .|:|...|:|.:...:.|||:.:.|||.|.|..|..|:||.           
  Fly    20 RPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDG 84

  Fly    87 --FDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPP 133
              .|.:...||||.|.|||..|:|.|:.::|.||||||:..|||:|..|
  Fly    85 QVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLPVAP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 26/68 (38%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 26/68 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.