DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:225 Identity:52/225 - (23%)
Similarity:81/225 - (36%) Gaps:62/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQHHH-------QHQHQNVNNIP--RDDKPDHHRHEDHRETSTWIPI------------------ 53
            |::||       .:.....:|||  .||:|  :.|:.:..|:|..|.                  
  Fly    87 GKYHHIPYPYDGGYGPYAGSNIPYVHDDRP--YNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPR 149

  Fly    54 -------------IKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQS 105
                         |.:.:|......|...|.|.|.|..||...|     :..|.....|.|.|..
  Fly   150 NILFNYDDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKL-----HHTGGTHAKGFYEYTG 209

  Fly   106 PEGTLVNVQYTADENGFRATGDHI-PTPPAI---------PEEIQKGLDQIYAGIKLQQERLEQR 160
            .:|.|..|.|.:::.||...|||| |.|.||         ..:|..|....:.|.::.....:.:
  Fly   210 DDGKLYRVNYASNDGGFMPQGDHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLK 274

  Fly   161 AKTDPDFARKLEERRVANQNGQYIGLLENQ 190
            |:..   |..|||  :..:..:.|.:||::
  Fly   275 AQIK---AIHLEE--MPKELTEQIHMLEHE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 16/55 (29%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.