DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC3290498

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_551138.3 Gene:LOC3290498 / 3290498 VectorBaseID:AGAMI1_002435 Length:510 Species:Anopheles gambiae


Alignment Length:66 Identity:24/66 - (36%)
Similarity:32/66 - (48%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTAD-ENGFR 123
            |.::.....:|.....|....||..|....:.:|.:|| |.||...|:||...|:|||| .|||.
Mosquito    56 QPEEYDANPQYSFSYGISDALTGDSKSQQESRSGDVVQ-GSYSVVDPDGTKRTVEYTADPHNGFN 119

  Fly   124 A 124
            |
Mosquito   120 A 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/56 (36%)
LOC3290498XP_551138.3 None

Return to query results.
Submit another query.