DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC3290497

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_551141.2 Gene:LOC3290497 / 3290497 VectorBaseID:AGAMI1_005151 Length:712 Species:Anopheles gambiae


Alignment Length:68 Identity:24/68 - (35%)
Similarity:34/68 - (50%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTAD-ENG 121
            :|...:..|...|...:::    ||..|....:.:|.:|| |.||...|:||...|:|||| .||
Mosquito   573 EEYDANPHYSFSYGISDAL----TGDSKSQQESRSGDVVQ-GSYSVVDPDGTKRTVEYTADPHNG 632

  Fly   122 FRA 124
            |.|
Mosquito   633 FNA 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/56 (36%)
LOC3290497XP_551141.2 None

Return to query results.
Submit another query.