DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr12A

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:134 Identity:32/134 - (23%)
Similarity:53/134 - (39%) Gaps:16/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DGSYKTEYETGNSIIHEETG-FLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATG 126
            ||||:..:|..:.....|.| |:|..|..   .|:..|.|:|:..:|..:.|.|.||:.|:|...
  Fly    43 DGSYEYRFELDDGTARYERGYFVKINDVK---TLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQ 104

  Fly   127 DHIPTP-PAIPEEIQ-------KGLDQIYAGIKLQQERLEQRAKTD----PDFARKLEERRVANQ 179
            ...|.. |.:|..|:       ........|:...|.:.:.:::.|    |............|:
  Fly   105 SITPQEYPNLPRSIEVPMVSEASAASAASDGVSSSQFQSQFQSRLDAHGNPSITTTTPRGAGTNR 169

  Fly   180 NGQY 183
            .|:|
  Fly   170 RGRY 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 16/56 (29%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.