DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC1279926

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_061510113.1 Gene:LOC1279926 / 1279926 VectorBaseID:AGAMI1_011969 Length:189 Species:Anopheles gambiae


Alignment Length:134 Identity:33/134 - (24%)
Similarity:48/134 - (35%) Gaps:53/134 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVLILLVLLAISCQGQHHHQHQHQNVNNIP----------RDDKPDHHRHEDHRETSTWIPIIKY 56
            ||.::|..:|:             .||::.          :.::.|.|....          ..|
Mosquito     4 KVFVVLAAVAV-------------GVNSVAIGVAAPATLVKTEEYDAHPQYS----------FSY 45

  Fly    57 NKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADE-N 120
            :.:.|..|..|.::||            :|.|       |..||||...|:||...|.||||. |
Mosquito    46 DVQDSLTGDNKQQHET------------RDGD-------VVQGQYSLVEPDGTRRTVDYTADPVN 91

  Fly   121 GFRA 124
            ||.|
Mosquito    92 GFNA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/56 (34%)
LOC1279926XP_061510113.1 None

Return to query results.
Submit another query.