DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC1276671

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_316041.4 Gene:LOC1276671 / 1276671 VectorBaseID:AGAMI1_005170 Length:106 Species:Anopheles gambiae


Alignment Length:89 Identity:30/89 - (33%)
Similarity:46/89 - (51%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSP 106
            :|.|...    |::|:.|......|:.|:.|.:.....|...|::..|:...:.|: |.|||..|
Mosquito    22 DDSRNAE----ILRYSSENIGIDGYRFEFATSDGTSRTEEAELRNPGTDNEAIAVR-GSYSYTGP 81

  Fly   107 EGTLVNVQYTADENGFRATGDHIP 130
            :||:..:.|.||||||:..|.|||
Mosquito    82 DGTVYVINYVADENGFQPEGAHIP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/55 (35%)
LOC1276671XP_316041.4 None

Return to query results.
Submit another query.