DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC1276669

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_316039.1 Gene:LOC1276669 / 1276669 VectorBaseID:AGAMI1_000057 Length:109 Species:Anopheles gambiae


Alignment Length:78 Identity:28/78 - (35%)
Similarity:42/78 - (53%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTA 117
            ::||..:.:....|..:::|.|.|..:|...||.|| :.|..||..|.||:...:|.:..|.|.|
Mosquito    32 LLKYENDHNGIDGYNFQFDTSNGIQRQEQAQLKQFD-DENAALVVRGSYSFTGDDGQVYTVNYVA 95

  Fly   118 DENGFRATGDHIP 130
            |||||:....|:|
Mosquito    96 DENGFQPEAPHLP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 22/55 (40%)
LOC1276669XP_316039.1 Chitin_bind_4 45..100 CDD:459790 22/55 (40%)

Return to query results.
Submit another query.