DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC1276668

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_316038.1 Gene:LOC1276668 / 1276668 VectorBaseID:AGAMI1_010311 Length:104 Species:Anopheles gambiae


Alignment Length:88 Identity:34/88 - (38%)
Similarity:45/88 - (51%) Gaps:5/88 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPE 107
            |.|:..    ::||..:......|..:|||.|:|...||..||:|..:. ..||..|.|||..|:
Mosquito    20 DERDAQ----VLKYENDNLGVDGYNFQYETSNNINRAETAELKNFGDDV-AALVVRGSYSYTGPD 79

  Fly   108 GTLVNVQYTADENGFRATGDHIP 130
            |.:..|.|.||||||:....|||
Mosquito    80 GQVYTVNYVADENGFQPEAPHIP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 25/55 (45%)
LOC1276668XP_316038.1 Chitin_bind_4 39..94 CDD:459790 25/55 (45%)

Return to query results.
Submit another query.