DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and LOC1272762

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_311670.4 Gene:LOC1272762 / 1272762 VectorBaseID:AGAMI1_005929 Length:138 Species:Anopheles gambiae


Alignment Length:74 Identity:24/74 - (32%)
Similarity:35/74 - (47%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYT 116
            |:..|:    .:..|...|...:::    ||..|....:.:|.:|. |.||...|:||...|:||
Mosquito    38 PLADYD----PNPQYSYSYAVSDAL----TGDNKSQQESRSGDVVS-GSYSLIEPDGTQRVVEYT 93

  Fly   117 ADE-NGFRA 124
            ||. |||.|
Mosquito    94 ADPVNGFNA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/56 (34%)
LOC1272762XP_311670.4 Chitin_bind_4 48..100 CDD:459790 19/56 (34%)

Return to query results.
Submit another query.