DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_311662.4 Gene:Cpr64Ac / 1272756 VectorBaseID:AGAMI1_002251 Length:164 Species:Anopheles gambiae


Alignment Length:98 Identity:32/98 - (32%)
Similarity:47/98 - (47%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIIKYNKEQSDDGSYKTEY-----ETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLV 111
            |::|:.:....:..|...|     .||:|...||        |..|||:  ||.||...|:||:.
Mosquito    62 PVLKHVEAYDPNPHYSFSYGVSDPHTGDSKHAEE--------TLSNGVV--HGSYSLTEPDGTIR 116

  Fly   112 NVQYTADE-NGFRA----TGDHIPTPPAIPEEI 139
            .|.||||: :||.|    :|..|.|.|.:.:.:
Mosquito   117 KVTYTADKIHGFNAVVEKSGHAIHTAPVLKKVV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 23/61 (38%)
Cpr64AcXP_311662.4 Chitin_bind_4 76..128 CDD:459790 23/61 (38%)

Return to query results.
Submit another query.