DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Ccp84Af

DIOPT Version :10

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:55 Identity:16/55 - (29%)
Similarity:24/55 - (43%) Gaps:11/55 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADE-NGFQPEGDHLPV 131
            :.|..||.|:.          |.||..|.||....::|.:|. |||....:.:|:
  Fly    79 QVEERDGDVVH----------GEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:459790 13/44 (30%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 13/44 (30%)

Return to query results.
Submit another query.