DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr78Cc

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:135 Identity:47/135 - (34%)
Similarity:70/135 - (51%) Gaps:38/135 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNAD--GSFNSSYETSNGI 63
            |:||...:.:||:|:.|.|...::.|             ::.:::||.||  |::..::||||||
  Fly     1 MFKLSLCLLAALMLANVYADNINKDA-------------VITREDVNPADAEGNYQYAFETSNGI 52

  Fly    64 RVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDH 128
            :.:..|.:..|                       :||.||..|:|..|:|.||||||||||:|||
  Fly    53 QAQEAGNVNGI-----------------------SGSSSYISPEGVPISLTYVADENGFQPQGDH 94

  Fly   129 LPVAP 133
            ||.||
  Fly    95 LPTAP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 22/68 (32%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.