DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:130 Identity:45/130 - (34%)
Similarity:59/130 - (45%) Gaps:37/130 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVENI 68
            :|.||..::||. |.|||.|   ...:.|...:....:||:     ||.:|..:||||||..:..
  Fly     6 VVVLVAMSVLLG-VQARPSD---SPDAHAEIRSFVNELKQE-----DGIYNYQFETSNGIAQQEQ 61

  Fly    69 ---GYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLP 130
               ||                         ..:||..|..|:|.||.|.|.||||||||:|:|||
  Fly    62 GVGGY-------------------------YASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101

  Fly   131  130
              Fly   102  101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 22/71 (31%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.