DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:130 Identity:32/130 - (24%)
Similarity:51/130 - (39%) Gaps:37/130 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVENIGY 70
            |.:..|.||:..||...               |.:::.:...|.|| |..:.|..|.:.|:..|.
  Fly     3 FFIAFACLLAVALANED---------------ANVLRAEQQVNVDG-FAYAVELDNSVNVQQKGD 51

  Fly    71 LKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQ--PEGDHLPVAP 133
            |                 ..||.|:  .||.|::.|:...::::|:||.||:|  .....||..|
  Fly    52 L-----------------NGEEWVV--KGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPP 97

  Fly   134  133
              Fly    98  97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 17/68 (25%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.