DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:95 Identity:38/95 - (40%)
Similarity:53/95 - (55%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVKQDNVNNADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYS 104
            |....|..|.||||:..|.:::|...:..||:|.:  ...|..:.|||.          |||||:
  Fly   107 ITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNL--GYGEGVEAQVIQ----------GSYSYT 159

  Fly   105 DPDGNLITLRYVADENGFQPEGDHLPVAPQ 134
            .|:|..||:||:||||||:.||..:|.:||
  Fly   160 SPEGTPITVRYIADENGFRAEGTGIPSSPQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 25/68 (37%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.