DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr47Ed

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:85 Identity:25/85 - (29%)
Similarity:43/85 - (50%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVKQDNVNNADGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYS 104
            |:|......:.||:..|:|:::|...|.:|.:         :||.:..|:..|:    :|.|.|.
  Fly    30 ILKSVTEQLSSGSYLFSFESADGTYREELGIV---------SSDSKTSDDDLEV----SGIYRYI 81

  Fly   105 DPDGNLITLRYVADENGFQP 124
            :..|..:.:||.||:|||.|
  Fly    82 NDWGQEVEVRYTADKNGFLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 18/68 (26%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:278791 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.