DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:131 Identity:52/131 - (39%)
Similarity:71/131 - (54%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVCSALLLSYVLARPQ----DQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVEN 67
            ||.:...||::.|:||    ..|..:..|     .|.|:||:...|.|||:..:||||||||.:.
  Fly    11 LVLALCCLSFIQAQPQRGLPPPRGNSFDA-----NAVILKQNFDLNPDGSYQYNYETSNGIRADE 70

  Fly    68 IGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLPVA 132
            .||||         :.|..|:..     |..|||||:.|||.:.|:.|:|||||::.||.|:|..
  Fly    71 AGYLK---------NPGSQIEAQ-----VMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTP 121

  Fly   133 P 133
            |
  Fly   122 P 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 29/68 (43%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.