DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Lcp4

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:51/135 - (37%) Gaps:45/135 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNN--ADGSFNSSYETSNGI 63
            |:| :.|||:.:.|......|:                  || :.||:  ||| |.|.....||.
  Fly     1 MFK-ILLVCALVALVAANENPE------------------VK-ELVNDVQADG-FVSKLVLDNGS 44

  Fly    64 RVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDH 128
            .....|                  |.|..:    .|.:.:..|:|..:.:.|.|||||:||:.|.
  Fly    45 AASATG------------------DVHGNI----DGVFEWVSPEGEHVRVSYKADENGYQPQSDL 87

  Fly   129 LPVAP 133
            ||..|
  Fly    88 LPTPP 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 15/68 (22%)
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.