DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ag and Pcp

DIOPT Version :9

Sequence 1:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:136 Identity:43/136 - (31%)
Similarity:61/136 - (44%) Gaps:36/136 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLV-FLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIR 64
            ||.|| |:|..|:|         ..:||::....:......::.|.....||.:..:|||||||.
  Fly     1 MYLLVNFIVALAVL---------QVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGIS 56

  Fly    65 V--ENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGD 127
            .  |.:|.                       |.||.|| ||:.|:|.:|::.|||||.|:.|.|.
  Fly    57 ASQEGLGG-----------------------VAVQGGS-SYTSPEGEVISVNYVADEFGYHPVGA 97

  Fly   128 HLPVAP 133
            |:|..|
  Fly    98 HIPQVP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 24/70 (34%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439251
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.