DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:120 Identity:36/120 - (30%)
Similarity:58/120 - (48%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IALFVVAASATDNDDPISQESNVEY--NGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKY 69
            :|.:..|..|..:..|:..::..||  :.:|.|.|:::|    :..|..||...:.:|:.|.|:|
  Fly    32 VATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQD----SLSGDSKSQVEERDGDVVRGEY 92

  Fly    70 SFVADDGKTYVVSYTADE-NGYLAVGDHLPTPPPTPVS-VLKALEYIRLHPYKTP 122
            |.:..||....|.||||. ||:.||.:..|......|: |:|.:.....| |..|
  Fly    93 SLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAH-YAAP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 20/55 (36%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.