DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:83 Identity:31/83 - (37%)
Similarity:42/83 - (50%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTP 100
            ||.:|.:     |.:|:......:.||  ..|...||:.:|.....||.||.|||...|||:|. 
  Fly    45 HYSFEFQ-----TTNGITTKGAGNENG--AVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIPA- 101

  Fly   101 PPTPVSVLKALEYIRLHP 118
              .|:.|::.|||||.||
  Fly   102 --IPLHVIRQLEYIRTHP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 16/53 (30%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.