DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr76Bb

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:61 Identity:26/61 - (42%)
Similarity:32/61 - (52%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADE-NGYLAV 93
            ||.:.|.:||.....|    ||.....:|:.|.|.||....||.|.||.||||: ||:.||
  Fly    85 KYQFDYGVKDAHTGDQ----KSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 22/55 (40%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 22/55 (40%)

Return to query results.
Submit another query.