DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr67Fa1

DIOPT Version :9

Sequence 1:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:133 Identity:47/133 - (35%)
Similarity:74/133 - (55%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYLMLIALFVVAA--SATDNDDP---ISQ-ESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADH 60
            :||::.:..:..|  :||.|.:.   |:: .|:::..|.|:|.||..:|..|.:.|:        
  Fly     3 RYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGI-------- 59

  Fly    61 NGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHP------Y 119
            .|...||.:|:.:.:|:...:||.||||||...|..||||||.|.::|::|||||.||      |
  Fly    60 GGNHANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHPQYVEQEY 124

  Fly   120 KTP 122
            :.|
  Fly   125 RRP 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 18/54 (33%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.